ALPI Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A6226-20UL
100 ul
£336.00
A6226-100UL
500 ul
£1258.00
A6226-500UL
1000 ul
£2228.00
A6226-1000UL
About this Product
- SKU:
- A6226
- Additional Names:
- ALPI|IAP
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 65kDa/75kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A6226
