TSG101/VPS23 Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A5789-20UL
100 ul
£342.00
A5789-100UL
About this Product
- SKU:
- A5789
- Additional Names:
- TSG10|VPS23
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TSG101/VPS23 (Q99816).
- Isotype:
- IgG
- Molecular Weight:
- 44kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A5789
