MT-ND1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A5250-20UL
100 ul
£336.00
A5250-100UL
500 ul
£1258.00
A5250-500UL
1000 ul
£2228.00
A5250-1000UL
About this Product
- SKU:
- A5250
- Additional Names:
- MT-ND1|TrnI
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable triplet codon-amino acid adaptor activity. Predicted to act upstream of or within translation. Predicted to be located in mitochondrion. Orthologous to human MT-TI (mitochondrially encoded tRNA-Ile (AUU/C)).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 36kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A5250
