PER2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A5107-5UL
20 ul
£164.00
A5107-20UL
100 ul
£342.00
A5107-100UL
500 ul
£1532.00
A5107-500UL
1000 ul
£2704.00
A5107-1000UL
About this Product
- SKU:
- A5107
- Additional Names:
- FASPS|FASPS1|PER2
- Application:
- ChIP, ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers and have been linked to sleep disorders.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 137 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A5107
