CD20 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A4893-5UL
20 ul
£164.00
A4893-20UL
100 ul
£342.00
A4893-100UL
500 ul
£1532.00
A4893-500UL
1000 ul
£2704.00
A4893-1000UL
About this Product
- SKU:
- A4893
- Additional Names:
- B1|Bp35|CD20|CVID5|FMC7|LEU-16|S7
- Application:
- Detection/Quantitation, ELISA, Flow Cytometry, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 25-35 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4893
