Caspase-2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A4888-5UL
20 ul
£164.00
A4888-20UL
100 ul
£342.00
A4888-100UL
500 ul
£1532.00
A4888-500UL
1000 ul
£2704.00
A4888-1000UL
About this Product
- SKU:
- A4888
- Additional Names:
- CASP-2|Caspase-2|ICH1|NEDD-2|NEDD2|PPP1R57
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimer's disease, Huntington's disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14kDa/48kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- GKNHTQSPGCEESDAGKEELMKMRLPTRSDMICGYACLKGNAAMRNTKRGSWYIEALTQVFSERACDMHVADMLVKVNALIKEREGYAPGTEFHRCKEMSEYCSTLCQQLYLFPGYPPT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4888
