BDNF Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A4873-5UL
20 ul
£164.00
A4873-20UL
100 ul
£342.00
A4873-100UL
500 ul
£1532.00
A4873-500UL
1000 ul
£2704.00
A4873-1000UL
About this Product
- SKU:
- A4873
- Additional Names:
- ANON2|BDNF|BULN2
- Application:
- ELISA, Immunofluorescence
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- VPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGID
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4873
