PI3 Kinase p85 beta Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A4860-5UL
20 ul
£164.00
A4860-20UL
100 ul
£342.00
A4860-100UL
500 ul
£1532.00
A4860-500UL
1000 ul
£2704.00
A4860-1000UL
About this Product
- SKU:
- A4860
- Additional Names:
- MPPH|MPPH1|p85|p85-BETA|P85B|p85beta|PI3 Kinase p85 beta
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Phosphatidylinositol 3-kinase (PI3K) is a lipid kinase that phosphorylates phosphatidylinositol and similar compounds, creating second messengers important in growth signaling pathways. PI3K functions as a heterodimer of a regulatory and a catalytic subunit. The protein encoded by this gene is a regulatory component of PI3K. Three transcript variants, one protein coding and the other two non-protein coding, have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 85kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- PRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALRE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4860
