NBAS Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A4748-20UL
100 ul
£336.00
A4748-100UL
500 ul
£1258.00
A4748-500UL
1000 ul
£2228.00
A4748-1000UL
About this Product
- SKU:
- A4748
- Additional Names:
- ILFS2|NAG|NBAS|SOPH
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a protein with two leucine zipper domains, a ribosomal protein S14 signature domain and a Sec39 like domain. The protein is thought to be involved in Golgi-to-ER transport. Mutations in this gene are associated with short stature, optic nerve atrophy, and Pelger-Huet anomaly.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 240kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- MAAPESGPALSPGTAEGEEETILYDLLVNTEWPPETEVQPRGNQKHGASFIITKAIRDRLLFLRQYIWYS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A4748
