[KO Validated] TRIM25 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A4347-5UL
20 ul
£164.00
A4347-20UL
100 ul
£342.00
A4347-100UL
500 ul
£1532.00
A4347-500UL
1000 ul
£2704.00
A4347-1000UL
About this Product
- SKU:
- A4347
- Additional Names:
- 25|EFP|RNF147|Z147|ZNF147
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein is an RNA binding protein, functions as a ubiquitin E3 ligase and is involved in multiple cellular processes, including regulation of antiviral innate immunity.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 70kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- SPNAQVACDHCLKEAAVKTCLVCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICLVEHKTCSPASLSQASADLEA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4347
