Histone H1.0 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A4342-5UL
20 ul
£164.00
A4342-20UL
100 ul
£342.00
A4342-100UL
500 ul
£1532.00
A4342-500UL
1000 ul
£2704.00
A4342-1000UL
About this Product
- SKU:
- A4342
- Additional Names:
- H1.0|H10|H1F0|H1FV|Histone H1.0
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-independent histone that is a member of the histone H1 family.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 32kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Other Species
- Sequence:
- MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4342
