COX1/PTGS1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A4301-5UL
20 ul
£164.00
A4301-20UL
100 ul
£342.00
A4301-100UL
500 ul
£1532.00
A4301-500UL
1000 ul
£2704.00
A4301-1000UL
About this Product
- SKU:
- A4301
- Additional Names:
- COX1|COX1/PTGS1|COX3|PCOX1|PES-1|PGG/HS|PGHS-1|PGHS1|PHS1|PTGHS
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This is one of two genes encoding similar enzymes that catalyze the conversion of arachidonate to prostaglandin. The encoded protein regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. Based on its ability to function as both a cyclooxygenase and as a peroxidase, the encoded protein has been identified as a moonlighting protein. The protein may promote cell proliferation during tumor progression. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 70 kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- GLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4301
