Peroxiredoxin 6 Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A4286-20UL
100 ul
£342.00
A4286-100UL
About this Product
- SKU:
- A4286
- Additional Names:
- 1-Cys|aiPLA2|AOP2|HEL-S-128m|LPCAT-5|NSGPx|p29|Peroxiredoxin 6|PRX
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 25kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- KGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4286




