Reptin/RUVBL2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A4227-5UL
20 ul
£164.00
A4227-20UL
100 ul
£342.00
A4227-100UL
500 ul
£1532.00
A4227-500UL
1000 ul
£2704.00
A4227-1000UL
About this Product
- SKU:
- A4227
- Additional Names:
- CGI-46|ECP-51|ECP51|INO80J|REPTIN|Reptin/RUVBL2|RVB2|TAP54-beta|TIH2|TIP48|TIP49B
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- LLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4227
