MRE11 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A4222-5UL
20 ul
£164.00
A4222-20UL
100 ul
£342.00
A4222-100UL
500 ul
£1532.00
A4222-500UL
1000 ul
£2704.00
A4222-1000UL
About this Product
- SKU:
- A4222
- Additional Names:
- ATLD|HNGS1|MRE11|MRE11A|MRE11B
- Application:
- ChIP, ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 81kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- RHREQKEKTGEEINFGKLITKPSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHIDALEDKIDEE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4222
