Lipoprotein lipase (LPL) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A4115-5UL
20 ul
£164.00
A4115-20UL
100 ul
£342.00
A4115-100UL
500 ul
£1532.00
A4115-500UL
1000 ul
£2704.00
A4115-1000UL
About this Product
- SKU:
- A4115
- Additional Names:
- HDLCQ11|LIPD|Lipoprotein lipase (LPL)
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 53kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- IPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A4115
