PGE receptor EP3 (PTGER3) Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A4057-20UL
100 ul
£336.00
A4057-100UL
500 ul
£1258.00
A4057-500UL
1000 ul
£2228.00
A4057-1000UL
About this Product
- SKU:
- A4057
- Additional Names:
- EP3|EP3-I|EP3-II|EP3-III|EP3-IV|EP3-VI|EP3e|lnc003875|PGE receptor EP3 (PTGER3)|PGE2-R
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A4057
