Myelin oligodendrocyte glycoprotein Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A3992-5UL
20 ul
£164.00
A3992-20UL
100 ul
£342.00
A3992-100UL
500 ul
£1532.00
A3992-500UL
1000 ul
£2704.00
A3992-1000UL
About this Product
- SKU:
- A3992
- Additional Names:
- BTN6|BTNL11|MOGIG2|Myelin oligodendrocyte glycoprotein|NRCLP7
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Myelin oligodendrocyte glycoprotein (NP_996532.2 ).
- Isotype:
- IgG
- Molecular Weight:
- 28kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTEL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A3992
