CKS2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A3791-20UL
100 ul
£336.00
A3791-100UL
500 ul
£1258.00
A3791-500UL
1000 ul
£2228.00
A3791-1000UL
About this Product
- SKU:
- A3791
- Additional Names:
- CKS2|CKSHS2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14kDa
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A3791
