Alpha Internexin Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A3596-5UL
20 ul
£164.00
A3596-20UL
100 ul
£342.00
A3596-100UL
500 ul
£1532.00
A3596-500UL
1000 ul
£2704.00
A3596-1000UL
About this Product
- SKU:
- A3596
- Additional Names:
- Alpha Internexin|NEF5|NF-66|NF66|TXBP-1
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 62-67kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- EVAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A3596
