[KD Validated] STAT2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A3588-5UL
20 ul
£164.00
A3588-20UL
100 ul
£342.00
A3588-100UL
500 ul
£1532.00
A3588-500UL
1000 ul
£2704.00
A3588-1000UL
About this Product
- SKU:
- A3588
- Additional Names:
- [KD Validated] STAT2|IMD44|ISGF-3|P113|PTORCH3|STAT113
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. The protein mediates innate antiviral activity. Mutations in this gene result in Immunodeficiency 44.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 97kDa/113kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- KLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDEL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A3588
