HE4/WFDC2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A3276-5UL
20 ul
£164.00
A3276-20UL
100 ul
£342.00
A3276-100UL
500 ul
£1532.00
A3276-500UL
1000 ul
£2704.00
A3276-1000UL
About this Product
- SKU:
- A3276
- Additional Names:
- dJ461P17.6|EDDM4|HE4|HE4/WFDC2|WAP5
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 20kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- CTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A3276
