WDR5 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A3259-5UL
20 ul
£164.00
A3259-20UL
100 ul
£342.00
A3259-100UL
500 ul
£1532.00
A3259-500UL
1000 ul
£2704.00
A3259-1000UL
About this Product
- SKU:
- A3259
- Additional Names:
- BIG-3|BIG3|CFAP89|SWD3|WDR5
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 37kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- DNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A3259
