FAM160B2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A3192-20UL
100 ul
£336.00
A3192-100UL
500 ul
£1258.00
A3192-500UL
1000 ul
£2228.00
A3192-1000UL
About this Product
- SKU:
- A3192
- Additional Names:
- FAI16|FAM160B2|RAI16|RAM160B2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Able to activate MAPK/ERK and TGFB signaling pathways. May regulate the activity of genes involved in intestinal barrier function and immunoprotective inflammation (By similarity. May play a role in cell proliferation.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 82kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- DRQPEAPGDNPHTLYAHLIGHCDHLSDEISITTLRLFEELLQKPHEGIIHSLVLRNLEGRPYVAWGSPEPESYEDTLDLEEDPYFTDSFLDSGFQTPAKPR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A3192
