CHRNA10 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A3042-20UL
100 ul
£336.00
A3042-100UL
500 ul
£1258.00
A3042-500UL
1000 ul
£2228.00
A3042-1000UL
About this Product
- SKU:
- A3042
- Additional Names:
- CHRNA10
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable acetylcholine-gated cation-selective channel activity. Acts upstream of or within positive regulation of cytosolic calcium ion concentration. Predicted to be located in membrane. Predicted to be active in cholinergic synapse and neuron projection. Predicted to be integral component of postsynaptic specialization membrane.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 45kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- AEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A3042
