KCNH2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A2968-20UL
100 ul
£336.00
A2968-100UL
500 ul
£1258.00
A2968-500UL
1000 ul
£2228.00
A2968-1000UL
About this Product
- SKU:
- A2968
- Additional Names:
- ERG-1|ERG1|H-ERG|HERG|HERG1|KCNH2|Kv11.1|LQT2|SQT1
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a component of a voltage-activated potassium channel found in cardiac muscle, nerve cells, and microglia. Four copies of this protein interact with one copy of the KCNE2 protein to form a functional potassium channel. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 148kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- DHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A2968
