FST Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A2936-20UL
100 ul
£336.00
A2936-100UL
500 ul
£1258.00
A2936-500UL
1000 ul
£2228.00
A2936-1000UL
About this Product
- SKU:
- A2936
- Additional Names:
- FS|FST
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- AACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A2936
