PLIN5 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A28371-20UL
100 ul
£336.00
A28371-100UL
500 ul
£1258.00
A28371-500UL
1000 ul
£2228.00
A28371-1000UL
About this Product
- SKU:
- A28371
- Additional Names:
- 2310076L09Rik|Lsdp5|MLDP|PAT-1
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables identical protein binding activity and lipase binding activity. Involved in several processes, including negative regulation of peroxisome proliferator activated receptor signaling pathway; positive regulation of triglyceride storage; and regulation of lipid metabolic process. Located in cytosol. Colocalizes with lipid droplet. Is expressed in brown fat. Orthologous to human PLIN5 (perilipin 5).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 55 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- GSVARAHACVDEFLDLVLRAMPLPWLVGPFAPILVEQSEPLINLATCVDEVVGDPDPRWAHMDWPAQKRAWEAESADPGGQEAEPPRGQGKHTMMPELDF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A28371
