Serotonin transporter Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A28369-20UL
100 ul
£336.00
A28369-100UL
500 ul
£1258.00
A28369-500UL
1000 ul
£2228.00
A28369-1000UL
About this Product
- SKU:
- A28369
- Additional Names:
- 5-HTT|Htt|Sert
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables neurotransmitter transmembrane transporter activity; nitric-oxide synthase binding activity; and serotonin:sodium:chloride symporter activity. Involved in several processes, including nervous system development; platelet aggregation; and serotonin uptake. Located in focal adhesion and synapse. Is expressed in several structures, including early conceptus; heart; liver; nervous system; and ovary. Used to study autism spectrum disorder and sudden infant death syndrome. Human ortholog(s) of this gene implicated in several diseases, including alcohol dependence; anxiety disorder (multiple); depressive disorder (multiple); heart disease (multiple); and substance abuse (multiple). Orthologous to human SLC6A4 (solute carrier family 6 member 4).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 83 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- METTPLNSQKVLSECKDKEDCQENGVLQKGVPTPADKAGPGQISNGYSAVPSTSAGDEAPHSTPAATTTLVAEIHQGERETWGKK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A28369
