ABflo[R] 610 Rabbit anti-Mouse CD11b monoclonal antibody
Product Sizes
50 ug
£229.00
A28363-50UG
100 ug
£372.00
A28363-100UG
About this Product
- SKU:
- A28363
- Additional Names:
- Cd11b|CD11b/CD18|CR3|CR3A|F730045J24Rik|Ly-40|Mac-1|Mac-1a|MAC1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo™ 610
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 127 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- ECPQQESDIVFLIDGSGSINNIDFQKMKEFVSTVMEQFKKSKTLFSLMQYSDEFRIHFTFNDFKRNPSPRSHVSPIKQLNGRTKTASGIRKVVRELFHKTNGARENAAKILVVITDGEKFGDPLDYKDVIPEADRAGVIRYVIGVGNAFNKPQSRRELDTIASKPAGEHVFQVDNFEALNTIQNQLQEKIFAIEG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28363
