PE Rabbit anti-Rat CD25 monoclonal antibody
Product Sizes
2.5 ug
£ POA
A28355-2.5UG
50 ug
£152.00
A28355-50UG
100 ug
£229.00
A28355-100UG
About this Product
- SKU:
- A28355
- Additional Names:
- IL2RAC
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- CD25, also known as the interleukin-2 receptor alpha chain (IL-2RA Alpha). It is widely expressed on activated T and B cells in rats, subsets of thymic and splenic dendritic cells, as well as on intestinal epithelial cells. IL-2 is a key cytokine involved in lymphocyte proliferation and clonal expansion. Signaling through IL-2 requires the high-affinity IL-2 receptor, which is composed of the A Alpha (CD25), B Beta (CD122), and G Gamma (CD132) chains.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 31 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28355
