PE Rabbit anti-Mouse CD70 monoclonal antibody
Product Sizes
50 ug
£146.00
A28353-50UG
100 ug
£211.00
A28353-100UG
About this Product
- SKU:
- A28353
- Additional Names:
- Cd27l|CD27LG|Tnfsf7|Tnlg8a
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 22 kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28353
