ZBP1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A28338-20UL
100 ul
£336.00
A28338-100UL
500 ul
£1258.00
A28338-500UL
1000 ul
£2228.00
A28338-1000UL
About this Product
- SKU:
- A28338
- Additional Names:
- 2010010H03Rik|Dai|Dlm1|mZaDLM
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables double-stranded RNA binding activity and left-handed Z-DNA binding activity. Involved in several processes, including defense response to other organism; positive regulation of defense response; and positive regulation of programmed cell death. Acts upstream of or within positive regulation of type I interferon-mediated signaling pathway. Located in cytoplasm and nucleus. Is expressed in eye and heart. Orthologous to human ZBP1 (Z-DNA binding protein 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42-62 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MAEAPVDLSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIGGAASGDGAPAIPENSSAQPSLDERILRFLEANGPHRALHIAKALGMTTAKEVNPLLYSMRNKHLLSYDGQTWKIYHSRQEGQDIAHSGVTQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A28338
