MYH6/AA Alpha-MHC Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A28325-5UL
20 ul
£164.00
A28325-20UL
100 ul
£342.00
A28325-100UL
500 ul
£1455.00
A28325-500UL
1000 ul
£2704.00
A28325-1000UL
About this Product
- SKU:
- A28325
- Additional Names:
- A830009F23Rik|alpha-MHC|alphaMHC|Myhc-a|Myhca
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables microfilament motor activity. Involved in cardiac muscle contraction. Acts upstream of or within several processes, including adult heart development; regulation of heart contraction; and striated muscle cell development. Located in Z disc and stress fiber. Part of myosin complex. Is expressed in several structures, including brown fat; embryo mesenchyme; great vessel of heart; heart; and skeletal musculature. Used to study dilated cardiomyopathy; dilated cardiomyopathy 1EE; and hypertrophic cardiomyopathy 14. Human ortholog(s) of this gene implicated in atrial heart septal defect (multiple); heart conduction disease (multiple); and intrinsic cardiomyopathy (multiple). Orthologous to human MYH6 (myosin heavy chain 6).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 250 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- LFSTYASADTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28325
