FDX1/ADX Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A28292-20UL
100 ul
£336.00
A28292-100UL
500 ul
£1258.00
A28292-500UL
1000 ul
£2228.00
A28292-1000UL
About this Product
- SKU:
- A28292
- Additional Names:
- ADX|FDX|FDX1|ferredoxin 1|LOH11CR1D
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Ferrodoxins are iron-sulfur proteins that facilitate monooxygenase reactions catalyzed by P450 enzymes. The protein encoded by this gene is present in the mitochondrial matrix and transfers electrons from ferredoxin reductase to steroidogenic mitochondrial cytochrome P450 proteins. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- ENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAFGLTDRSRLGCQVCLTKAMDNMTVRVPEAVADVRQSVDMSKNS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A28292
