APC Rabbit anti-Mouse IL-4 monoclonal antibody
Product Sizes
2.5 ug
£ POA
A28267-2.5UG
25 ug
£116.00
A28267-25UG
100 ug
£241.00
A28267-100UG
About this Product
- SKU:
- A28267
- Additional Names:
- BSF-1|Il-4
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- APC
- Extra Details:
- IL-4 is a pleiotropic cytokine produced by activated T cells, mast cells, and basophils. It serves as a potent lymphocyte growth factor that stimulates the growth and activation of certain B and T cells. IL-4 plays a critical role in regulating the development of T helper cell subsets.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 16 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28267
