ABflo[R] 647 Rabbit anti-Mouse CD119/IFN-gamma receptor 1 monoclonal antibody
Product Sizes
5 ug
£ POA
A28265-5UG
50 ug
£181.00
A28265-50UG
100 ug
£259.00
A28265-100UG
About this Product
- SKU:
- A28265
- Additional Names:
- CD119|Ifgr|IFN-gammaR|Ifngr|Nktar
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Predicted to enable cytokine receptor activity. Involved in several processes, including astrocyte activation; negative regulation of amyloid-beta clearance; and positive regulation of macromolecule metabolic process. Acts upstream of or within defense response to virus. Predicted to be located in several cellular components, including dendrite; endoplasmic reticulum; and postsynaptic density. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system; cerebral cortex; cranium; female reproductive system; and liver. Used to study osteoporosis. Human ortholog(s) of this gene implicated in asthma; hepatitis B; immunodeficiency 27A; immunodeficiency 27B; and tuberculosis. Orthologous to human IFNGR1 (interferon gamma receptor 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28265
