ABflo[R] 594 Rabbit anti-Mouse CX3CR1 monoclonal antibody
Product Sizes
5 ug
£ POA
A28252-5UG
25 ug
£164.00
A28252-25UG
100 ug
£306.00
A28252-100UG
About this Product
- SKU:
- A28252
- Additional Names:
- mCX3CR1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Enables C-X3-C chemokine binding activity and C-X3-C chemokine receptor activity. Involved in several processes, including antifungal innate immune response; central nervous system development; and synapse organization. Located in cell surface. Is expressed in several structures, including brain; colon; genitourinary system; head mesenchyme; and meninges. Used to study age related macular degeneration 12. Human ortholog(s) of this gene implicated in several diseases, including human immunodeficiency virus infectious disease; obesity; pulmonary hypertension; retinal disease (multiple); and systemic scleroderma. Orthologous to human CX3CR1 (C-X3-C motif chemokine receptor 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 40 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MSTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSVFYALVFTFGLVGNLLVVLALTNSRKPKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28252
