PE Rabbit anti-Mouse CD206/MMR monoclonal antibody
Product Sizes
2.5 ug
£ POA
A28215-2.5UG
25 ug
£146.00
A28215-25UG
100 ug
£265.00
A28215-100UG
About this Product
- SKU:
- A28215
- Additional Names:
- CD206|MR
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Macrophage Mannose Receptor (MMR), also known as MR, is designated CD206, MRC1 (Mannose Receptor C-type 1), or CLEC13D (C-type Lectin Domain Family 13 Member D) due to its presence on cells beyond macrophages. CD206 is a 175 kDa endocytic receptor expressed on M2 selectively activated tissue macrophages, including tumor-associated macrophages (TAMs), inflammatory dendritic cells in specific lymphoid organs, and liver, spleen, lymphatic, and dermal microvascular endothelial cells.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 165 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- LDARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28215
