ABflo[R] 450 Rabbit anti-Mouse/Rat CD31/PECAM1 monoclonal antibody
Product Sizes
5 ug
£ POA
A28212-5UG
25 ug
£146.00
A28212-25UG
100 ug
£306.00
A28212-100UG
About this Product
- SKU:
- A28212
- Additional Names:
- Cd31|Pecam|PECAM-1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo™ 450
- Extra Details:
- Predicted to enable protein homodimerization activity; protein phosphatase binding activity; and transmembrane signaling receptor activity. Acts upstream of or within several processes, including Rho protein signal transduction; endothelial cell morphogenesis; and positive regulation of tyrosine phosphorylation of STAT protein. Located in several cellular components, including cell-cell contact zone; external side of plasma membrane; and smooth muscle contractile fiber. Is expressed in several structures, including alimentary system; cardiovascular system; central nervous system; extraembryonic component; and genitourinary system. Human ortholog(s) of this gene implicated in coronary artery disease (multiple); lung non-small cell carcinoma; neuroblastoma; and psoriatic arthritis. Orthologous to human PECAM1 (platelet and endothelial cell adhesion molecule 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 81 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28212
