Gata3 Rabbit PolymAb[R]
Product Sizes
5 ul
£ POA
A28206PM-5UL
20 ul
£164.00
A28206PM-20UL
100 ul
£342.00
A28206PM-100UL
500 ul
£1532.00
A28206PM-500UL
1000 ul
£2704.00
A28206PM-1000UL
About this Product
- SKU:
- A28206PM
- Additional Names:
- Gata-3|jal
- Application:
- ChIP, ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- GATA-3 is a transcription factor belonging to the GATA family, which binds to the consensus DNA sequence (A/T)GATA(A/G), controlling various tissue-specific programs of gene expression and morphogenesis. It is widely expressed in tissues derived from the mesoderm and endoderm. GATA-3 has been proven to be an essential regulatory factor for immune cell function, the development of sympathetic neurons, and the maintenance of the differentiation state of epithelial cells.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 48 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- VLNGQHPDTHHPGLGHSYMEAQYPLTEEVDVLFNIDGQGNHVPSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALSSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVQLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSST
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28206PM
