PE Rabbit anti-Mouse CD235a/Glycophorin A monoclonal antibody
Product Sizes
2.5 ug
£ POA
A28200-2.5UG
25 ug
£193.00
A28200-25UG
100 ug
£342.00
A28200-100UG
About this Product
- SKU:
- A28200
- Additional Names:
- CD235a|GPA
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Enables identical protein binding activity. Acts upstream of or within regulation of response to osmotic stress. Located in external side of plasma membrane. Is expressed in liver and yolk sac. Human ortholog(s) of this gene implicated in malaria. Orthologous to several human genes including GYPA (glycophorin A (MNS blood group)).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 18 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28200
