PE Rabbit anti-Chicken CD25 monoclonal antibody
Product Sizes
50 ug
£360.00
A28169-50UG
100 ug
£556.00
A28169-100UG
About this Product
- SKU:
- A28169
- Additional Names:
- CD25|IDDM10|Il2r|IMD41|Ly-43|p55|TCGFR
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 24 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Avian
- Sequence:
- DKCPRLSTTEFADVAAETYPLKTKLRYECDSGYRRRSGNTLTIRCQNVSGTASWVHDELVCIDEKFLFSRNHTAKLNPTQQPARQTQSPAPPKQANNSSFCGMPQTVPHASLSVHQIYSVGQVLHFKCPTGYNKQLPTTGTITCKNVDGRIKWTPADRPCTNDSGPINKQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28169
