PE Rabbit anti-Chicken CD25 monoclonal antibody
Product Sizes
2.5 ug
£ POA
A28169-2.5UG
50 ug
£360.00
A28169-50UG
100 ug
£556.00
A28169-100UG
About this Product
- SKU:
- A28169
- Additional Names:
- CD25|IDDM10|Il2r|IMD41|Ly-43|p55|TCGFR
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- CD25 is the A Alpha chain of the heterotrimeric IL-2 receptor and is highly expressed in many types of hematologic malignancies but shows low expression in most solid tumors. CD25 is also abundantly expressed on activated circulating immune cells and regulatory T cells (Tregs). The infiltration of Tregs into the tumor microenvironment can lead to an imbalance in the ratio of effector T cells (Teffs) to Tregs, which is associated with tumor progression. Restoring a balanced Teff/Treg ratio may enhance the efficacy of immunotherapy. As a potential target for Treg depletion, CD25 plays a critical role in the development of novel immunotherapeutic strategies.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 24 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Avian
- Sequence:
- DKCPRLSTTEFADVAAETYPLKTKLRYECDSGYRRRSGNTLTIRCQNVSGTASWVHDELVCIDEKFLFSRNHTAKLNPTQQPARQTQSPAPPKQANNSSFCGMPQTVPHASLSVHQIYSVGQVLHFKCPTGYNKQLPTTGTITCKNVDGRIKWTPADRPCTNDSGPINKQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28169
