PE Rabbit anti-Mouse CD122/IL-2RB Beta monoclonal antibody
Product Sizes
2.5 ug
£ POA
A28145-2.5UG
25 ug
£122.00
A28145-25UG
100 ug
£217.00
A28145-100UG
About this Product
- SKU:
- A28145
- Additional Names:
- CD122|IL-15Rbeta|Il-2/15Rbeta|Il-2Rbeta|IL15Rbeta|p70
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- The interleukin 2 receptor is composed of alpha and beta subunits. The beta subunit encoded by this gene is very homologous to the human beta subunit and also shows structural similarity to other cytokine receptors.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 60 kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28145
