ABflo[R] 647 Rabbit anti-Rat CD8a monoclonal antibody
Product Sizes
50 ug
£181.00
A28120-50UG
100 ug
£259.00
A28120-100UG
About this Product
- SKU:
- A28120
- Additional Names:
- CD8A Alpha|Ly-2|Lyt2|T8
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 32kd
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- GQLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28120
