ABflo[R] 647 Rabbit anti-Rat CD8a monoclonal antibody
Product Sizes
5 ug
£ POA
A28120-5UG
50 ug
£181.00
A28120-50UG
100 ug
£259.00
A28120-100UG
About this Product
- SKU:
- A28120
- Additional Names:
- CD8A Alpha|Ly-2|Lyt2|T8
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- CD8a, a 32 kDa glycoprotein also known as T8, Lyt2, Ly-2, and CD8A Alpha, is a member of the immunoglobulin superfamily. It is expressed on most thymocytes, subsets of mature T cells, the majority of NK cells, macrophages, and some activated (non-resting) CD4+ T cells. CD8a forms a heterodimer with the CD8B Beta chain (CD8b) on the surface of most thymocytes. In contrast, mature peripheral T lymphocytes predominantly express the CD8 A AlphaB Beta heterodimer. Intestinal intraepithelial lymphocytes express CD8a but lack CD8b expression. CD8 functions as an antigen co-receptor on T cells, interacting with Major Histocompatibility Complex (MHC) class I molecules on antigen-presenting cells or epithelial cells. CD8 participates in T cell activation by associating with the T cell receptor (TCR) complex and the protein tyrosine kinase lck (p56lck).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 32kd
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- GQLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28120
