CLEC4E Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A28097-20UL
100 ul
£336.00
A28097-100UL
500 ul
£1258.00
A28097-500UL
1000 ul
£2228.00
A28097-1000UL
About this Product
- SKU:
- A28097
- Additional Names:
- Clecsf9|Mincle
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables glycolipid binding activity and pattern recognition receptor activity. Involved in antifungal innate immune response and positive regulation of cytokine production. Acts upstream of or within Fc-gamma receptor signaling pathway; T cell differentiation involved in immune response; and defense response to bacterium. Is active in phagocytic vesicle membrane and plasma membrane. Orthologous to human CLEC4E (C-type lectin domain family 4 member E).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 25kDa
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- TQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A28097
