APC Rabbit anti-Human CD47 monoclonal antibody
Product Sizes
10 tests
£ POA
A28071-10TESTS
100 tests
£259.00
A28071-100TESTS
200 tests
£419.00
A28071-200TESTS
500 tests
£866.00
A28071-500TESTS
About this Product
- SKU:
- A28071
- Additional Names:
- IAP|MER6|OA3
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- APC
- Extra Details:
- This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 31kDa/33kDa/35kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28071
