ABflo[R] 647 Rabbit anti-Human CD134/OX40 monoclonal antibody
Product Sizes
10 tests
£ POA
A28035-10TESTS
100 tests
£312.00
A28035-100TESTS
200 tests
£515.00
A28035-200TESTS
500 tests
£1098.00
A28035-500TESTS
About this Product
- SKU:
- A28035
- Additional Names:
- ACT35|CD134|IMD16|OX40|TXGP1L
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- CD134, also known as OX40 and TNFRSF4, is a 50 kDa type I transmembrane glycoprotein. It is a member of the tumor necrosis factor receptor superfamily (TNFRSF). OX40 is expressed on activated T lymphocytes, including Th1, Th2, Th17, and Treg cell subsets. The interaction between OX40 and its ligand OX40L (TNFSF4) induces B cell proliferation and antibody secretion, and modulates primary T cell expansion and T cell survival. Furthermore, OX40 influences the size of the T cell memory pool and modulates CD4+ T cell tolerance.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 29kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28035
