RB Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A28033-5UL
20 ul
£164.00
A28033-20UL
100 ul
£342.00
A28033-100UL
500 ul
£1532.00
A28033-500UL
1000 ul
£2704.00
A28033-1000UL
About this Product
- SKU:
- A28033
- Additional Names:
- OSRC|p105-Rb|p110-RB1|pp110|PPP1R130|pRb|RB
- Application:
- ELISA, IHC-Paraffin, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 110 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- DQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28033
