PerCP Rabbit anti-Human CD34 monoclonal antibody
Product Sizes
10 tests
£ POA
A28019-10TESTS
100 tests
£342.00
A28019-100TESTS
200 tests
£562.00
A28019-200TESTS
500 tests
£1199.00
A28019-500TESTS
About this Product
- SKU:
- A28019
- Additional Names:
- CD34|CD34 molecule|GIG3|MORT1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- PerCP
- Extra Details:
- The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 41kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- DIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28019
